PDB entry 2hdm

View 2hdm on RCSB PDB site
Description: Solution structure of V21C/V59C Lymphotactin/XCL1
Class: cytokine
Keywords: Lymphotactin, XCL1, chemokine, NMR, conformational restriction, CYTOKINE
Deposited on 2006-06-20, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lymphotactin
    Species: Homo sapiens [TaxId:9606]
    Gene: XCL1, LTN, SCYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47992 (0-End)
      • engineered (19)
      • engineered (57)
    Domains in SCOPe 2.08: d2hdma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hdmA (A:)
gsevsdkrtcvslttqrlpcsriktytitegslravifitkrglkvcadpqatwvrdcvr
smdrksntrnnmiqtkptgtqqstntavtltg

    Sequence, based on observed residues (ATOM records): (download) 
    >2hdmA (A:)
gsevsdkrtcvslttqrlpcsriktytitegslravifitkrglkvcadpqatwvrdcvr
smdrksntrnnmiq