PDB entry 2hb8

View 2hb8 on RCSB PDB site
Description: Crystal structure of VDR LBD in complex with 2alpha-methyl calcitriol
Class: gene regulation
Keywords: alpha helical sandwich, GENE REGULATION
Deposited on 2006-06-14, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hb8a_
  • Heterogens: MVD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hb8A (A:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hb8A (A:)
    slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
    ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
    nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
    alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
    csmkltplvlevfg