PDB entry 2h8g

View 2h8g on RCSB PDB site
Description: 5'-Methylthioadenosine Nucleosidase from Arabidopsis thaliana
Class: hydrolase
Keywords: Protein-adenine complex, HYDROLASE
Deposited on 2006-06-07, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h8ga_
  • Chain 'B':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h8gb_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h8gA (A:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h8gA (A:)
    ilrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgr
    daalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdr
    ripipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdm
    egaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfing
    rnlsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h8gB (B:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h8gB (B:)
    rpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgrda
    algidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdrri
    pipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdmeg
    aavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfingrn
    lsdl