PDB entry 2h80

View 2h80 on RCSB PDB site
Description: NMR structures of SAM domain of Deleted in Liver Cancer 2 (DLC2)
Class: lipid binding protein
Keywords: Helical bundle, LIPID BINDING PROTEIN
Deposited on 2006-06-06, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StAR-related lipid transfer protein 13
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3M8 (16-80)
      • expression tag (0-15)
    Domains in SCOPe 2.06: d2h80a1, d2h80a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h80A (A:)
    mhhhhhhssglvprgsqeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdfle
    kdlveplcrrlntlnkcasmk