PDB entry 2h7v

View 2h7v on RCSB PDB site
Description: Co-crystal structure of YpkA-Rac1
Class: signaling protein
Keywords: YpkA, YopO, Rac1, GDI, GTPase, Yersinia, SIGNALING PROTEIN
Deposited on 2006-06-04, released 2006-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Migration-inducing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: MIG5, RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • cloning artifact (4-5)
      • cloning artifact (4-5)
      • engineered (81)
    Domains in SCOPe 2.06: d2h7va_
  • Chain 'B':
    Compound: Migration-inducing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: MIG5, RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • cloning artifact (4-5)
      • cloning artifact (4-5)
      • engineered (81)
    Domains in SCOPe 2.06: d2h7vb_
  • Chain 'C':
    Compound: Protein kinase ypkA
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypkA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein kinase ypkA
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypkA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h7vA (A:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7vA (A:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h7vB (B:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7vB (B:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.