PDB entry 2h77

View 2h77 on RCSB PDB site
Description: Crystal structure of human TR alpha bound T3 in monoclinic space group
Class: hormone/growth factor
Keywords: TR alpha, T3, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-06-01, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THRA protein
    Species: Homo sapiens [TaxId:9606]
    Gene: THRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FH41
      • modified residue (192)
      • modified residue (238)
      • engineered (246)
      • modified residue (250)
    Domains in SCOPe 2.06: d2h77a_
  • Heterogens: T3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h77A (A:)
    argshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspi
    vsmpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimsl
    raavrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqa
    vllmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigach
    asrflhckvecptelfpplflevfedqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h77A (A:)
    rslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsmpdgdkvd
    leafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydpes
    dtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmstdrsg
    llcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflhckve
    cptelfpplflevfe