PDB entry 2h74

View 2h74 on RCSB PDB site
Description: Crystal Structure of Thioredoxin Mutant D2E in Hexagonal (p61) Space Group
Class: electron transport
Keywords: Alpha Beta, Electron transport
Deposited on 2006-06-01, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Escherichia coli [TaxId:562]
  Gene: trxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2M889 (0-107)
    • engineered (1)
  Domains in SCOPe 2.06: d2h74a_
• Chain 'B':
  Compound: thioredoxin
  Species: Escherichia coli [TaxId:562]
  Gene: trxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2M889 (0-107)
    • engineered (1)
  Domains in SCOPe 2.06: d2h74b_
• Heterogens: MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h74A (A:)
  sekiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h74B (B:)
  sekiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla