PDB entry 2h6x

View 2h6x on RCSB PDB site
Description: Crystal Structure of Thioredoxin Wild Type in Hexagonal (p61) Space Group
Class: electron transport
Keywords: Alpha Beta, Electron transport
Deposited on 2006-06-01, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Gene: trxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h6xa_
  • Chain 'B':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Gene: trxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h6xb_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h6xA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h6xB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla