PDB entry 2h64

View 2h64 on RCSB PDB site
Description: Crystal structure of a ternary ligand-receptor complex of BMP-2
Class: Hormone/Growth Factor
Keywords: TGF-beta superfamily, ligand-receptor complex, Hormone/Growth Factor COMPLEX
Deposited on 2006-05-30, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP2, BMP2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12643 (Start-113)
      • engineered (99)
      • engineered (101)
    Domains in SCOPe 2.06: d2h64a1
  • Chain 'B':
    Compound: Bone morphogenetic protein receptor type IA
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1A, ACVRLK3, ALK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h64b_
  • Chain 'C':
    Compound: Acvr2b protein
    Species: Mus musculus [TaxId:10090]
    Gene: Acvr2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h64c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h64A (A:)
    qakhkqrkrlkssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnh
    aivqtlvnsvnskipkaccvptelsaismlyldenekvvkkdyqdmvvegcgcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h64A (A:)
    lkssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvns
    vnskipkaccvptelsaismlyldenekvvkkdyqdmvvegcgcr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h64B (B:)
    qnldsmlhgtgmksdsdqkksengvtlapedtlpflkcycsghcpddainntcitnghcf
    aiieeddqgettlasgcmkyegsdfqckdspkaqlrrtieccrtnlcnqylqptlppvvi
    gpffdgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h64B (B:)
    tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
    kaqlrrtieccrtnlcnqylqptlppvvigpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h64C (C:)
    sgrgeaetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcw
    lddfncydrqecvateenpqvyfcccegnfcnerfthlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h64C (C:)
    aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
    cydrqecvateenpqvyfcccegnfcnerfthlp