PDB entry 2h5z

View 2h5z on RCSB PDB site
Description: Crystallographic structure of digestive lysozyme 1 from Musca domestica bound to chitotetraose at 1.92 A resolution
Class: Hydrolase
Keywords: Lysozyme, ligant, Musca domestica, Hydrolase
Deposited on 2006-05-29, released 2007-06-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2h5za_
  • Chain 'B':
    Compound: Lysozyme 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2h5zb_
  • Heterogens: CTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h5zA (A:)
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h5zB (B:)
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf