PDB entry 2h4z

View 2h4z on RCSB PDB site
Description: Human bisphosphoglycerate mutase complexed with 2,3-bisphosphoglycerate
Class: isomerase
Keywords: bisphosphoglycerate mutase, 2,3-bisphosphoglycerate, isomerase
Deposited on 2006-05-25, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4za_
  • Chain 'B':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4zb_
  • Heterogens: DG2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h4zA (A:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4zA (A:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkvedqgkvkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h4zB (B:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4zB (B:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkvedqgkvk