PDB entry 2h4x

View 2h4x on RCSB PDB site
Description: Human bisphosphoglycerate mutase complex with 3-phosphoglycerate with crystal growth 90 days
Class: isomerase
Keywords: bisphosphoglycerate mutase, 3-phosphoglycerate, isomerase
Deposited on 2006-05-25, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4xa_
  • Chain 'B':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4xb_
  • Heterogens: 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h4xA (A:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4xA (A:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkvedqgkvkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h4xB (B:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4xB (B:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkvedqgkv