PDB entry 2h32

View 2h32 on RCSB PDB site
Description: Crystal structure of the pre-B cell receptor
Class: immune system
Keywords: beta sheets, v and c-type Ig folds, IMMUNE SYSTEM
Deposited on 2006-05-22, released 2007-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.269
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin iota chain
    Species: Homo sapiens [TaxId:9606]
    Gene: VPREB1, VPREB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2h32a_
  • Chain 'B':
    Compound: Immunoglobulin omega chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLL1, IGL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H32 (0-222)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h32A (A:)
    qpvlhqppamssalgttirltctlrndhdigvysvywyqqrpghpprfllryfsqsdksq
    gpqvpprfsgskdvarnrgylsiselqpedeamyycamgarssekeerereweeemepta
    artrvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h32A (A:)
    qpvlhqppamssalgttirltctlrndhdigvysvywyqqrpghpprfllryfsqsdksq
    gpqvpprfsgskdvarnrgylsiselqpedeamyycamgarssekeerere
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.