PDB entry 2h2p

View 2h2p on RCSB PDB site
Description: Crystal structure of CLC-ec1 in complex with Fab fragment in SeCN-
Class: ion transport
Keywords: CLC; transporter; chloride; antiport
Deposited on 2006-05-19, released 2006-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.278
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CLC Cl transporter
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h2pa1
  • Chain 'B':
    Compound: CLC Cl transporter
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h2pb1
  • Chain 'C':
    Compound: Fab fragment, heavy chain
    Species: MUS MUSCULUS
    Gene:
  • Chain 'D':
    Compound: Fab fragment, light chain
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.73: d2h2pd1, d2h2pd2
  • Chain 'E':
    Compound: Fab fragment, heavy chain
    Species: MUS MUSCULUS
    Gene:
  • Chain 'F':
    Compound: Fab fragment, light chain
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.73: d2h2pf1, d2h2pf2
  • Heterogens: SEK

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2pA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2pA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h2pB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2pB (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplysailartlakqea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h2pD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h2pF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra