PDB entry 2h2k

View 2h2k on RCSB PDB site
Description: Crystal Structure Analysis of Human S100A13
Class: metal binding protein
Keywords: calcium binding protein, METAL BINDING PROTEIN
Deposited on 2006-05-19, released 2007-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99584 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d2h2ka1, d2h2ka2
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h2kb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2kA (A:)
    hhhhhhslmaaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkd
    vgsldekmksldvnqdselkfneywrligelakeirkkkdlkirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2kA (A:)
    slmaaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgslde
    kmksldvnqdselkfneywrligelakeirkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h2kB (B:)
    hhhhhhslmaaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkd
    vgsldekmksldvnqdselkfneywrligelakeirkkkdlkirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2kB (B:)
    aeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmks
    ldvnqdselkfneywrligelakeirkkkdlki