PDB entry 2h2b

View 2h2b on RCSB PDB site
Description: Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
Class: cell adhesion
Keywords: PDZ Domain, Phage Derived High Affinity Ligand, CELL ADHESION
Deposited on 2006-05-18, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ZO1 (TJP1)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (4-96)
      • cloning artifact (0-3)
      • linker (97-99)
      • see remark 999 (100-106)
    Domains in SCOPe 2.08: d2h2ba1, d2h2ba2, d2h2ba3
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h2bA (A:)
gshmiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqend
rvamvngvsmdnvehafavqqlrksgknakitirrkkgggwrrttyl