PDB entry 2h1p

View 2h1p on RCSB PDB site
Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes
Deposited on 1997-11-12, released 1998-01-28
The last revision prior to the SCOP 1.63 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pH (H:)
    dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
    pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pL (L:)
    dvvmtqtplslpvslgdpasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdkfsgsgsgtdftlkisrveaedqgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdedskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec