PDB entry 2h1p

View 2h1p on RCSB PDB site
Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes
Class: complex (antibody/peptide)
Keywords: antibody structure, cryptococcus, peptide, phage library, polysaccharide, complex (antibody/peptide)
Deposited on 1997-11-12, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 2h1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S38864 (1-219)
      • conflict (4)
      • conflict (9)
      • conflict (13)
      • conflict (26)
      • conflict (32-33)
      • conflict (39)
      • conflict (41)
      • conflict (46)
      • conflict (51)
      • conflict (53)
      • conflict (55-56)
      • conflict (59)
      • conflict (62-63)
      • conflict (92)
      • conflict (98-100)
      • conflict (102-105)
      • conflict (107)
      • conflict (114-115)
      • conflict (119-120)
    Domains in SCOPe 2.07: d2h1ph1, d2h1ph2
  • Chain 'L':
    Compound: 2h1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (17)
      • conflict (38)
      • conflict (50)
      • conflict (54)
      • conflict (65)
      • conflict (87)
      • conflict (93)
      • conflict (95)
      • conflict (100)
      • conflict (107)
      • conflict (170)
    Domains in SCOPe 2.07: d2h1pl1, d2h1pl2
  • Chain 'P':
    Compound: pa1
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2H1P (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pH (H:)
    dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
    pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pL (L:)
    dvvmtqtplslpvslgdpasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdkfsgsgsgtdftlkisrveaedqgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdedskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.