PDB entry 2h1c

View 2h1c on RCSB PDB site
Description: Crystal Structure of FitAcB from Neisseria gonorrhoeae
Class: gene regulation
Keywords: DNA binding, PIN domain, RHH domain, GENE REGULATION
Deposited on 2006-05-16, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trafficking protein b
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fitB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RF91 (0-137)
      • cloning artifact (138)
    Domains in SCOPe 2.08: d2h1ca1, d2h1ca2
  • Chain 'B':
    Compound: trafficking protein a
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fitA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h1cA (A:)
milldtnviseplrpqpnervvawldsliledvylsaitvaelrlgvalllngkkknvlh
erleqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsltvat
rdtgsffaadvavfnpwhl

  • Chain 'B':
    No sequence available.