PDB entry 2h0p

View 2h0p on RCSB PDB site
Description: NMR Structure of the Dengue-4 virus Envelope Protein Domain III
Class: viral protein
Keywords: BETA SANDWICH, Ig-fold, VIRAL PROTEIN
Deposited on 2006-05-15, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: Dengue virus 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h0pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h0pA (A:)
    meklrikgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvv
    griisstplaentnsvtnieleppfgdsyivigvgnsaltlhwfrkgssigk