PDB entry 2gzh

View 2gzh on RCSB PDB site
Description: Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2
Class: Protein Transport
Keywords: Ras-like G protein fold, a-helical coiled coil, Protein Transport
Deposited on 2006-05-11, released 2006-08-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-172)
      • engineered (69)
      • modified residue (119)
    Domains in SCOPe 2.05: d2gzha_
  • Chain 'B':
    Compound: RAB11-FIP2 long isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L804
      • modified residue (83)
    Domains in SCOPe 2.05: d2gzhb1
  • Heterogens: PO4, MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzhA (A:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzhA (A:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gzhB (B:)
    gamaakfrasnimpsssfhmsptsnedlrkipdsnpfdatagyrsltyeevlqelvkhke
    llrrkdthireledyidnllvrvmeetpsilrvpyepsrkagkfsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzhB (B:)
    gyrsltyeevlqelvkhkellrrkdthireledyidnllvrvmeetpsilrvpyeps