PDB entry 2gzd

View 2gzd on RCSB PDB site
Description: Crystal Structure of Rab11 in Complex with Rab11-FIP2
Class: Protein Transport
Keywords: G protein folds, a-helical coiled coil, Protein Transport
Deposited on 2006-05-11, released 2006-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-172)
      • engineered (69)
      • modified residue (119)
    Domains in SCOPe 2.03: d2gzda_
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-172)
      • engineered (69)
      • modified residue (119)
    Domains in SCOPe 2.03: d2gzdb_
  • Chain 'C':
    Compound: Rab11 family-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L804
      • modified residue (83)
    Domains in SCOPe 2.03: d2gzdc1
  • Chain 'D':
    Compound: Rab11 family-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L804
      • modified residue (83)
    Domains in SCOPe 2.03: d2gzdd_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzdA (A:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzdA (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gzdB (B:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzdB (B:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gzdC (C:)
    gamaakfrasnimpsssfhmsptsnedlrkipdsnpfdatagyrsltyeevlqelvkhke
    llrrkdthireledyidnllvrvmeetpsilrvpyepsrkagkfsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzdC (C:)
    rrkdthireledyidnllvrvmeetpsilrvpyep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gzdD (D:)
    gamaakfrasnimpsssfhmsptsnedlrkipdsnpfdatagyrsltyeevlqelvkhke
    llrrkdthireledyidnllvrvmeetpsilrvpyepsrkagkfsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzdD (D:)
    rrkdthireledyidnllvrvmeetpsilrvpyep