PDB entry 2gzb

View 2gzb on RCSB PDB site
Description: Bauhinia bauhinioides cruzipain inhibitor (BbCI)
Class: hydrolase inhibitor
Keywords: Cruzipain, Kunitz, cysteine proteinase inhibitor, HYDROLASE INHIBITOR
Deposited on 2006-05-11, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type proteinase inhibitor BbCI
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83051 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2gzba1, d2gzba2
  • Chain 'B':
    Compound: Kunitz-type proteinase inhibitor BbCI
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83051 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d2gzbb1, d2gzbb2
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzbA (A:)
    hmsvildtkgepvsnaadayylvpvshgegglalakvgneaepkavvldphhrpgltvrf
    etplaiaiitesfflnikfvpsssdsevwdvskqypiglavkvtdtksfvgpfrvekege
    gykivyypdrgqtgldiglvhrndkyylaategepfvfkirkatye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzbA (A:)
    hmsvildtkgepvsnaadayylvpvshgegglalakvgneaepkavvldphhrpgltvrf
    etplaiaiitesfflnikfvpsssdsevwdvskqypiglavkvtdtksfvgpfrvekege
    gykivyypdrgqtgldiglvhrndkyylaategepfvfkirkat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gzbB (B:)
    hmsvildtkgepvsnaadayylvpvshgegglalakvgneaepkavvldphhrpgltvrf
    etplaiaiitesfflnikfvpsssdsevwdvskqypiglavkvtdtksfvgpfrvekege
    gykivyypdrgqtgldiglvhrndkyylaategepfvfkirkatye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzbB (B:)
    msvildtkgepvsnaadayylvpvshgegglalakvgneaepkavvldphhrpgltvrfe
    tplaiaiitesfflnikfvpsssdsevwdvskqypiglavkvtdtksfvgpfrvekegeg
    ykivyypdrgqtgldiglvhrndkyylaategepfvfkirkat