PDB entry 2gyv

View 2gyv on RCSB PDB site
Description: Crystal structure of Mus musculus Acetylcholinesterase in complex with Ortho-7
Class: hydrolase
Keywords: Acetylcholinesterase, AChE, oxime, reactivator, Ortho-7, HYDROLASE
Deposited on 2006-05-10, released 2006-08-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2gyva_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2gyvb_
  • Heterogens: NAG, CO3, HBP, P3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gyvA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    sat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyvA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdf
    lsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigv
    pqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvya
    yifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartg
    dpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gyvB (B:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    sat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyvB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsd
    tpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpqa
    sdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayif
    ehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdpn
    dprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat