PDB entry 2gwx

View 2gwx on RCSB PDB site
Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
Class: transcription
Keywords: ppar, fatty acids, transcription, nuclear receptor fold
Deposited on 1999-03-11, released 2000-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ppar-delta)
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-End)
      • conflict (219)
    Domains in SCOPe 2.07: d2gwxa_
  • Chain 'B':
    Compound: protein (ppar-delta)
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-266)
      • conflict (219)
    Domains in SCOPe 2.07: d2gwxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gwxA (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gwxA (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gwxB (B:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy