PDB entry 2gws

View 2gws on RCSB PDB site
Description: Crystal Structure of human DNA Polymerase lambda with a G/G mismatch in the primer terminus
Class: Transferase/DNA
Keywords: DNA polymerase lambda, family X, mismatch extension, mutagenesis, NHEJ, Transferase-DNA COMPLEX
Deposited on 2006-05-05, released 2006-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gwsa1, d2gwsa2, d2gwsa3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'E':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gwse1, d2gwse2, d2gwse3
  • Chain 'F':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*tp*gp*cp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'I':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gwsi1, d2gwsi2, d2gwsi3
  • Chain 'J':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
  • Chain 'K':
    Compound: 5'-d(*gp*tp*gp*cp*gp*g)-3'
  • Chain 'L':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'M':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gwsm1, d2gwsm2, d2gwsm3
  • Chain 'N':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
  • Chain 'P':
    Compound: 5'-d(*gp*tp*gp*cp*gp*g)-3'
  • Chain 'Q':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'R':
    Compound: 5'-d(*gp*tp*gp*cp*gp*g)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
  • Heterogens: NA, MG, CAC, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gwsA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gwsA (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gwsE (E:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gwsE (E:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2gwsI (I:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gwsI (I:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2gwsM (M:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gwsM (M:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.