PDB entry 2gvp

View 2gvp on RCSB PDB site
Description: Solution structure of Human apo Sco1
Class: transport protein
Keywords: Thioredoxin-like fold, metalloprotein, Structural Genomics, Structural Proteomics in Europe, SPINE, TRANSPORT PROTEIN
Deposited on 2006-05-03, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SCO1 protein homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SCO1, SCOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75880 (3-172)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2gvpa1, d2gvpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gvpA (A:)
sftgkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeid
sittlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspg
pkdededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks