PDB entry 2gva

View 2gva on RCSB PDB site
Description: refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Class: DNA-binding (viral)
Keywords: DNA-binding (viral)
Deposited on 1995-07-27, released 1995-10-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gene v protein
  Species: Enterobacteria phage M13 [TaxId:10870]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69544 (0-86)
    • conflict (40)
  Domains in SCOPe 2.02: d2gvaa_
• Chain 'B':
  Compound: gene v protein
  Species: Enterobacteria phage M13 [TaxId:10870]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69544 (0-86)
    • conflict (40)
  Domains in SCOPe 2.02: d2gvab_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gvaA (A:)
  mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
  ytvhlssfkvgqfgslmidrlrlvpak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gvaB (B:)
  mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
  ytvhlssfkvgqfgslmidrlrlvpak