PDB entry 2gv5

View 2gv5 on RCSB PDB site
Description: crystal structure of Sfi1p/Cdc31p complex
Class: cell cycle
Keywords: Sfi1p, centrin, cdc31p, spindle pole body, centrosome, CELL CYCLE
Deposited on 2006-05-02, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.255
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704 (Start-160)
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2gv5a_
  • Chain 'B':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704 (Start-160)
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2gv5b_
  • Chain 'C':
    Compound: SFI1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SFI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12369 (5-72)
      • cloning artifact (0-4)
      • modified residue (55)
  • Chain 'D':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704 (Start-160)
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2gv5d_
  • Chain 'E':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704 (Start-160)
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2gv5e_
  • Chain 'F':
    Compound: SFI1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SFI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12369 (5-72)
      • cloning artifact (0-4)
      • modified residue (55)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gv5A (A:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gv5A (A:)
    lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg
    rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde
    elramieefdldgdgeinenefiaictds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gv5B (B:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gv5B (B:)
    nselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegr
    hlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdee
    lramieefdldgdgeinenefiaictds
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gv5D (D:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gv5D (D:)
    selleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegrh
    lmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdeel
    ramieefdldgdgeinenefiaictds
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gv5E (E:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gv5E (E:)
    nselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegr
    hlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdee
    lramieefdldgdgeinenefiaictds
    

  • Chain 'F':
    No sequence available.