PDB entry 2guu

View 2guu on RCSB PDB site
Description: crystal structure of Plasmodium vivax orotidine 5-monophosphate decarboxylase with 6-aza-UMP bound
Class: structural genomics, unknown function
Keywords: ODcase, 6-aza-UMP, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2006-05-01, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ODcase
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GUU
    Domains in SCOPe 2.07: d2guua1
  • Heterogens: UP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2guuA (A:)
    mgsshhhhhhssglvprgsnlkiklqkrrdevntclcigldpdeadiksfmqsekqngyq
    svkknlsnsgssssssnsssgkgelfapqmggqmllaetppkeaqekdeffyffnhfcfy
    iinetkeyalaykmnfafylpygslgvdvlknvfdylhhlnvptildikmndigntvkhy
    rkfifdylrsdsctaniymgtqmlrdicldeeckryystfvlvkttnadshifqnrlsld
    gkeayvviaeeaqkmakqlhleengefvgfvvgancydeikkirelfpdcyilapgvgaq
    kgdlrkmlcngysknyekvlinvgraitksgspqqaareyhqqikevlaelqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2guuA (A:)
    lkiklqkrrdevntclcigldpdeadiksfmqsekqngyqsvkknlsnsgelfapqmggq
    mllaetppkeaqekdeffyffnhfcfyiinetkeyalaykmnfafylpygslgvdvlknv
    fdylhhlnvptildikmndigntvkhyrkfifdylrsdsctaniymgtqmlrdicldckr
    yystfvlvkttnadshifqnrlsldgkeayvviaeeaqkmakqlhleengefvgfvvgan
    cydeikkirelfpdcyilapgvgaqkgdlrkmlcngysknyekvlinvgraitksgspqq
    aareyhqqikevlaelq