PDB entry 2gts

View 2gts on RCSB PDB site
Description: Structure of Protein of Unknown Function HP0062 from Helicobacter pylori
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, hypothetical protein, Helicobacter pylori, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2006-04-28, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein HP0062
  Species: Helicobacter pylori [TaxId:210]
  Gene: GeneID:899000, HP0062
  Database cross-references and differences (RAF-indexed):
  • GB NP_206862
  Domains in SCOPe 2.08: d2gtsa1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2gtsA (A:)
  msrvqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkst
  fnefdeaaqeqiawlkerirvleedy
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2gtsA (A:)
  vqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfne
  fdeaaqeqiawlkerir