PDB entry 2gtn

View 2gtn on RCSB PDB site
Description: Mutated MAP kinase P38 (Mus Musculus) in complex with Inhbitor PG-951717
Class: transferase
Keywords: MAP KINASE P38, P38, Transferase
Deposited on 2006-04-28, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtna_
  • Heterogens: SO4, LIE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtnA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtnA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaatrwyrapeiml
    nwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesa
    rnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpd
    depvadpydqsfesrdllidewksltydevisfvppp