PDB entry 2gsr

View 2gsr on RCSB PDB site
Description:
Deposited on 1996-03-21, released 1996-11-08
The last revision prior to the SCOP 1.69 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.165
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2gsra1, d2gsra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2gsrb1, d2gsrb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsrA (A:)
    ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
    yqsnailrhlgrsfglygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkel
    pehlkpfetllsqnqggqafvvgsqisfadynlldllrihqvlnpscldafpllsayvar
    lsarpkikaflaspehvnrpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsrB (B:)
    ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
    yqsnailrhlgrsfglygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkel
    pehlkpfetllsqnqggqafvvgsqisfadynlldllrihqvlnpscldafpllsayvar
    lsarpkikaflaspehvnrpingngkq