PDB entry 2gsq

View 2gsq on RCSB PDB site
Description:
Deposited on 1995-04-14, released 1996-04-12
The last revision prior to the SCOP 1.69 freeze date was dated 1996-04-12, with a file datestamp of 1996-04-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2gsq_1, d2gsq_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsq_ (-)
    pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
    sqsmciarhlarefgldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnye
    ksckrlapflegllvsngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkival
    rkrvaecpkiaaylkkrpvrdf