PDB entry 2gsm

View 2gsm on RCSB PDB site
Description: Catalytic Core (Subunits I and II) of Cytochrome c oxidase from Rhodobacter sphaeroides
Class: oxidoreductase
Keywords: transmembrane protein complex
Deposited on 2006-04-26, released 2006-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: RHODOBACTER SPHAEROIDES
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gsma1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: RHODOBACTER SPHAEROIDES
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • his tag (256-259)
    Domains in SCOP 1.75: d2gsmb1, d2gsmb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 1
    Species: RHODOBACTER SPHAEROIDES
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gsmc1
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: RHODOBACTER SPHAEROIDES
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • his tag (256-259)
    Domains in SCOP 1.75: d2gsmd1, d2gsmd2
  • Heterogens: DMU, CU, MG, CA, CD, OH, HEA, TRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gsmA (A:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsmA (A:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gsmB (B:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsmB (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gsmC (C:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsmC (C:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gsmD (D:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsmD (D:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh