PDB entry 2gsb

View 2gsb on RCSB PDB site
Description: Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1
Class: signaling protein
Keywords: GTPase-activating protein, GAP, Ras p21 protein activator, p120GAP, RasGAP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-26, released 2007-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.05: d2gsba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsbA (A:)
    gssgssgreedphegkiwfhgkiskqeaynllmtvgqvcsflvrpsdntpgdyslyfrtn
    eniqrfkicptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmqdqsgpssg