PDB entry 2gqx

View 2gqx on RCSB PDB site
Description: Crystal structure of cytochrome p450cam mutant (f87w/y96f/l244a/v247l/c334a) with pentachlorobenzene
Class: oxidoreductase
Keywords: Cytochrome P450 Mutant P450cam, OXIDOREDUCTASE
Deposited on 2006-04-22, released 2007-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (0-404)
      • engineered mutation (77)
      • engineered mutation (86)
      • engineered mutation (234)
      • engineered mutation (237)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d2gqxa_
  • Chain 'B':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (0-404)
      • engineered mutation (77)
      • engineered mutation (86)
      • engineered mutation (234)
      • engineered mutation (237)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d2gqxb_
  • Heterogens: K, HEM, 5CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gqxA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgalllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gqxB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgalllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav