PDB entry 2gq0

View 2gq0 on RCSB PDB site
Description: Crystal Structure of the Middle Domain of HtpG, the E. coli Hsp90
Class: Chaperone, hydrolase
Keywords: MOLECULAR CHAPERONE, HSP90, HTPG, E. COLI, Chaperone, hydrolase
Deposited on 2006-04-19, released 2006-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein htpG
    Species: Escherichia coli [TaxId:562]
    Gene: htpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gq0a_
  • Chain 'B':
    Compound: Chaperone protein htpG
    Species: Escherichia coli [TaxId:562]
    Gene: htpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gq0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gq0A (A:)
    maqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdm
    wnrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnl
    rnaltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtd
    ssaqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewm
    mnyltefdgkpfqsvskvdeslekladgdlgtlvprgsmaisdpnsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gq0A (A:)
    aqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmw
    nrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlr
    naltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtds
    saqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmm
    nyltefdgkpfqsvsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gq0B (B:)
    maqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdm
    wnrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnl
    rnaltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtd
    ssaqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewm
    mnyltefdgkpfqsvskvdeslekladgdlgtlvprgsmaisdpnsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gq0B (B:)
    qalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmwn
    rdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlrn
    altkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtdss
    aqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmmn
    yltefdgkpfqsvskvdeslekla