PDB entry 2gp7

View 2gp7 on RCSB PDB site
Description: Estrogen Related Receptor-gamma ligand binding domain
Class: transcription
Keywords: Estrogen related receptor, ERR, ERRg, ESRRG, Nuclear Receptor, Steroid Receptor, TRANSCRIPTION
Deposited on 2006-04-17, released 2006-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gp7a_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gp7b_
  • Chain 'C':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gp7c_
  • Chain 'D':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gp7d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gp7A (A:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp7A (A:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gp7B (B:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp7B (B:)
    ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
    ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
    kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
    agkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gp7C (C:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp7C (C:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gp7D (D:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gp7D (D:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv