PDB entry 2gom

View 2gom on RCSB PDB site
Description: Crystal structure of Efb-C from Staphylococcus aureus
Class: cell adhesion/toxin
Keywords: three-helix closed bundle with left-hand twist, CELL ADHESION-TOXIN COMPLEX
Deposited on 2006-04-13, released 2007-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.211
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibrinogen-binding protein
  Species: Staphylococcus aureus [TaxId:158878]
  Gene: efb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68798 (0-60)
  Domains in SCOPe 2.08: d2goma1
• Chain 'B':
  Compound: Fibrinogen-binding protein
  Species: Staphylococcus aureus [TaxId:158878]
  Gene: efb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68798 (Start-60)
  Domains in SCOPe 2.08: d2gomb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gomA (A:)
  ikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglv
  r
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2gomB (B:)
  ikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglv
  r
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2gomB (B:)
  kkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglvr