PDB entry 2goj

View 2goj on RCSB PDB site
Description: The crystal structure of the enzyme Fe-superoxide dismutase from Plasmodium falciparum
Class: Oxidoreductase
Keywords: BETA+ALPHA STRUCTURE, Oxidoreductase
Deposited on 2006-04-13, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fe-superoxide dismutase
    Species: Plasmodium falciparum [TaxId:137071]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • GB CAA89971 (0-End)
    Domains in SCOPe 2.07: d2goja1, d2goja2
  • Chain 'B':
    Compound: fe-superoxide dismutase
    Species: Plasmodium falciparum [TaxId:137071]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • GB CAA89971 (0-End)
    Domains in SCOPe 2.07: d2gojb1, d2gojb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gojA (A:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkamkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gojA (A:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkamk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gojB (B:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkamkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gojB (B:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkam