PDB entry 2go0

View 2go0 on RCSB PDB site
Description: NMR solution structure of human pancreatitis-associated protein
Class: protein binding
Keywords: C-type lectin, fibril, PROTEIN BINDING
Deposited on 2006-04-12, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regenerating islet-derived protein 3 alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2go0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2go0A (A:)
    rcpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksigns
    ysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaflrw
    kdyncnvrlpyvckftd