PDB entry 2gmr

View 2gmr on RCSB PDB site
Description: Photosynthetic reaction center mutant from Rhodobacter sphaeroides with Asp L210 replaced with Asn
Class: photosynthesis
Keywords: photosynthetic reaction center, integral membrane protein, electron transport, proton transfer, L210DN, mutant, PHOTOSYNTHESIS
Deposited on 2006-04-07, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Photosynthetic reaction center protein H chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gmrh1, d2gmrh2
  • Chain 'L':
    Compound: Photosynthetic Reaction center protein L chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3J1A5 (0-End)
      • engineered (209)
    Domains in SCOPe 2.06: d2gmrl1
  • Chain 'M':
    Compound: Photosynthetic Reaction center protein M chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gmrm_
  • Heterogens: FE2, BCL, BPH, U10, SPN, LDA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gmrH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmrH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaamlae
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2gmrL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpnhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmrL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpnhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipggin
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2gmrM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gmrM (M:)
    qnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsg
    lmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmf
    vavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshl
    dwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgt
    aaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn