PDB entry 2gmg

View 2gmg on RCSB PDB site
Description: Solution NMR Structure of protein PF0610 from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfG3
Class: DNA binding protein
Keywords: winged-helix like protein with metal binding site, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DNA BINDING PROTEIN
Deposited on 2006-04-06, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein Pf0610
  Species: Pyrococcus furiosus [TaxId:186497]
  Gene: AE010183
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U362 (9-104)
    • expression tag (0-8)
  Domains in SCOPe 2.08: d2gmga1, d2gmga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gmgA (A:)
  ahhhhhhgsatrrekiielllegdyspselarildmrgkgskkviledlkviskiakreg
  mvllikpaqcrkcgfvfkaeinipsrcpkcksewieeprfklerk