PDB entry 2gm8

View 2gm8 on RCSB PDB site
Description: TenA Homolog/Thi-4 Thiaminase complexed with product 4-amino-5-hydroxymethyl-2-methylpyrimidine
Class: transferase
Keywords: thiaminase, transcription, transferase
Deposited on 2006-04-06, released 2006-04-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tenA homolog/Thi-4 Thiaminase
    Species: Pyrobaculum aerophilum [TaxId:178306]
    Gene: tena/thi4 (pag5_170)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZZM9 (10-220)
      • cloning artifact (4-9)
    Domains in SCOPe 2.01: d2gm8a_
  • Chain 'B':
    Compound: tenA homolog/Thi-4 Thiaminase
    Species: Pyrobaculum aerophilum [TaxId:178306]
    Gene: tena/thi4 (pag5_170)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZZM9 (10-220)
      • cloning artifact (8-9)
    Domains in SCOPe 2.01: d2gm8b_
  • Chain 'C':
    Compound: tenA homolog/Thi-4 Thiaminase
    Species: Pyrobaculum aerophilum [TaxId:178306]
    Gene: tena/thi4 (pag5_170)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZZM9 (10-220)
      • cloning artifact (6-9)
    Domains in SCOPe 2.01: d2gm8c_
  • Chain 'D':
    Compound: tenA homolog/Thi-4 Thiaminase
    Species: Pyrobaculum aerophilum [TaxId:178306]
    Gene: tena/thi4 (pag5_170)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZZM9 (10-220)
      • cloning artifact (4-9)
    Domains in SCOPe 2.01: d2gm8d_
  • Heterogens: HMH, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gm8A (A:)
    malhhhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfa
    kalslaasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsy
    maylkstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrg
    lverlravldssglsaeelwpyfkeaslyelefwqaayegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm8A (A:)
    hhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakals
    laasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymayl
    kstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglver
    lravldssglsaeelwpyfkeaslyelefwqaayegh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gm8B (B:)
    malhhhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfa
    kalslaasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsy
    maylkstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrg
    lverlravldssglsaeelwpyfkeaslyelefwqaayegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm8B (B:)
    hgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaas
    rapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstc
    alegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlrav
    ldssglsaeelwpyfkeaslyelefwqaayegh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gm8C (C:)
    malhhhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfa
    kalslaasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsy
    maylkstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrg
    lverlravldssglsaeelwpyfkeaslyelefwqaayegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm8C (C:)
    hhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalsla
    asrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylks
    tcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlr
    avldssglsaeelwpyfkeaslyelefwqaayegh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gm8D (D:)
    malhhhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfa
    kalslaasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsy
    maylkstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrg
    lverlravldssglsaeelwpyfkeaslyelefwqaayegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gm8D (D:)
    hhhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakals
    laasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymayl
    kstcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglver
    lravldssglsaeelwpyfkeaslyelefwqaayegh