PDB entry 2glr

View 2glr on RCSB PDB site
Description: molecular structure at 1.8 angstroms of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
Deposited on 1994-05-04, released 1994-07-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2glrA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2glrB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq