PDB entry 2gl8

View 2gl8 on RCSB PDB site
Description: Human Retinoic acid receptor RXR-gamma ligand-binding domain
Class: Hormone/Growth factor receptor
Keywords: nuclear receptor, Structural Genomics, Structural Genomics Consortium, SGC, Hormone-Growth factor receptor COMPLEX
Deposited on 2006-04-04, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRG, NR2B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gl8a_
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRG, NR2B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gl8b_
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRG, NR2B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gl8c_
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRG, NR2B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gl8d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gl8A (A:)
    gshnatsghedmpverileaelavepktesygdmnmenstndpvtnichaadkqlftlve
    wakriphfsdltledqvillragwnelliasfshrsvsvqdgillatglhvhrssahsag
    vgsifdrvltelvskmkdmqmdkselgclraivlfnpdakglsnpsevetlrekvyatle
    aytkqkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemletplqi
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl8A (A:)
    dmpverileaelaveaadkqlftlvewakriphfsdltledqvillragwnelliasfsh
    rsvsvqdgillatglhvhrssahsagvgsifdrvltelvskmkdmqmdkselgclraivl
    fnpdakglsnpsevetlrekvyatleaytkqkypeqpgrfaklllrlpalrsiglkcleh
    lfffkligdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gl8B (B:)
    gshnatsghedmpverileaelavepktesygdmnmenstndpvtnichaadkqlftlve
    wakriphfsdltledqvillragwnelliasfshrsvsvqdgillatglhvhrssahsag
    vgsifdrvltelvskmkdmqmdkselgclraivlfnpdakglsnpsevetlrekvyatle
    aytkqkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemletplqi
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl8B (B:)
    dmpverileaelaveaadkqlftlvewakriphfsdltledqvillragwnelliasfsh
    rsvsvqdgillatglhvhrssahsagvgsifdrvltelvskmkdmqmdkselgclraivl
    fnpdakglsnpsevetlrekvyatleaytkqkypeqpgrfaklllrlpalrsiglkcleh
    lfffkligdtpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gl8C (C:)
    gshnatsghedmpverileaelavepktesygdmnmenstndpvtnichaadkqlftlve
    wakriphfsdltledqvillragwnelliasfshrsvsvqdgillatglhvhrssahsag
    vgsifdrvltelvskmkdmqmdkselgclraivlfnpdakglsnpsevetlrekvyatle
    aytkqkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemletplqi
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl8C (C:)
    dmpverileaelavepaadkqlftlvewakriphfsdltledqvillragwnelliasfs
    hrsvsvqdgillatglhvhrssahsagvgsifdrvltelvskmkdmqmdkselgclraiv
    lfnpdakglsnpsevetlrekvyatleaytkqkypeqpgrfaklllrlpalrsiglkcle
    hlfffkligdtpid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gl8D (D:)
    gshnatsghedmpverileaelavepktesygdmnmenstndpvtnichaadkqlftlve
    wakriphfsdltledqvillragwnelliasfshrsvsvqdgillatglhvhrssahsag
    vgsifdrvltelvskmkdmqmdkselgclraivlfnpdakglsnpsevetlrekvyatle
    aytkqkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemletplqi
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gl8D (D:)
    dmpverileaelavepaadkqlftlvewakriphfsdltledqvillragwnelliasfs
    hrsvsvqdgillatglhvhrssahsagvgsifdrvltelvskmkdmqmdkselgclraiv
    lfnpdakglsnpsevetlrekvyatleaytkqkypeqpgrfaklllrlpalrsiglkcle
    hlfffkligdtpidt