PDB entry 2gki

View 2gki on RCSB PDB site
Description: Heavy and light chain variable single domains of an anti-DNA binding antibody hydrolyze both double- and single-stranded DNAs without sequence specificity
Class: immune system
Keywords: anti-DNA antibody, catalytic antibody, IMMUNE SYSTEM
Deposited on 2006-04-02, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.212
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAF79128 (22-141)
      • see remark 999 (159)
      • see remark 999 (230)
      • cloning artifact (271-272)
    • GB AAF79129 (158-270)
    Domains in SCOPe 2.06: d2gkia1, d2gkia2, d2gkia3
  • Chain 'B':
    Compound: Nuclease
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAF79128 (22-141)
      • linker (156-157)
      • see remark 999 (159)
      • see remark 999 (230)
      • cloning artifact (271-273)
    • GB AAF79129 (158-270)
    Domains in SCOPe 2.06: d2gkib1, d2gkib2, d2gkib3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gkiA (A:)
    mkqstialallpllftpvtkarevqlqqsgpelvkpgasvkmsckasgytftsyvmhwvk
    qkpgqglewigyinpyndgtkynekfkgkatltsdkssstaymelssltsedsavyycar
    gaykrgyamdywgqgtsvtvssrggggsggggsggggsdlvmsqspsslavsagekvtms
    ckssqslfnsrtrknylawyqqkpgqspklliywastresgvpdrftgsgsgtdftltis
    svqaedlavyyckqsyyhmytfgsgtkleikhhhhhglvprgsgdpkadnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gkiA (A:)
    evqlqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycargaykrgyamdywgqgtsvtvss
    dlvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleikhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gkiB (B:)
    mkqstialallpllftpvtkarevqlqqsgpelvkpgasvkmsckasgytftsyvmhwvk
    qkpgqglewigyinpyndgtkynekfkgkatltsdkssstaymelssltsedsavyycar
    gaykrgyamdywgqgtsvtvssrggggsggggsggggsdlvmsqspsslavsagekvtms
    ckssqslfnsrtrknylawyqqkpgqspklliywastresgvpdrftgsgsgtdftltis
    svqaedlavyyckqsyyhmytfgsgtkleikhhhhhglvprgsgdpkadnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gkiB (B:)
    evqlqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycargaykrgyamdywgqgtsvtvss
    gsdlvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywas
    tresgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleikhhh