PDB entry 2gkg

View 2gkg on RCSB PDB site
Description: Receiver domain from Myxococcus xanthus social motility protein FrzS
Class: signaling protein
Keywords: social motility, receiver domain, signalling, high resolution, SIGNALING PROTEIN
Deposited on 2006-04-01, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.092
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulator homolog
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: FrzS
    Database cross-references and differences (RAF-indexed):
    • GB AAC98490 (Start-126)
    Domains in SCOPe 2.07: d2gkga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gkgA (A:)
    gshmskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdls
    agqngylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlverag
    aligfpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gkgA (A:)
    kkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagqng
    ylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlveragaligf
    pe