PDB entry 2gk0

View 2gk0 on RCSB PDB site
Description: Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2
Class: immune system
Keywords: immunoglobulin,catalytic antibody, elimination, IMMUNE SYSTEM
Deposited on 2006-03-31, released 2007-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic elimination antibody 13G5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2gk0a1, d2gk0a2
  • Chain 'B':
    Compound: Catalytic elimination antibody 13G5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Catalytic elimination antibody 13G5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Catalytic elimination antibody 13G5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2gk0l1, d2gk0l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gk0A (A:)
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrn

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gk0L (L:)
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrn